PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30190.m011329
Common NameLOC8258445, RCOM_1674040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SBP
Protein Properties Length: 141aa    MW: 15997.7 Da    PI: 7.4766
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30190.m011329genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.94.4e-4157133278
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    Cq+e+C+ d++eak+yhrrhkvCe+h+kap vlvsg++qrfCqqCsrfhe+sefD++krsCrrrLa+hnerrrk+++
  30190.m011329  57 CQAENCTFDMTEAKRYHRRHKVCEHHAKAPCVLVSGIHQRFCQQCSRFHEVSEFDDTKRSCRRRLAGHNERRRKSSS 133
                    **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375751.5E-581141IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.101.6E-3250118IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.43654131IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.59E-3855135IPR004333Transcription factor, SBP-box
PfamPF031102.9E-3157130IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MATSKAEGKR SLKEMEDDEE EEDDEDGGCG LGFSEDEKKR KGKKGSSASG SMPPVSCQAE  60
NCTFDMTEAK RYHRRHKVCE HHAKAPCVLV SGIHQRFCQQ CSRFHEVSEF DDTKRSCRRR  120
LAGHNERRRK SSSEYHGEGS I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3648130284squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002509450.12e-99PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ387412e-48SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLB9RBB62e-99B9RBB6_RICCO; Squamosa promoter-binding-like protein
STRINGVIT_10s0003g00050.t015e-55(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.18e-41squamosa promoter binding protein-like 3